Skip to content

Commit

Permalink
delete peptide evidences endpoint
Browse files Browse the repository at this point in the history
  • Loading branch information
ypriverol committed Sep 25, 2024
1 parent 4535aef commit a9e2ee4
Show file tree
Hide file tree
Showing 3 changed files with 0 additions and 72 deletions.
Empty file removed peptide/__init__.py
Empty file.
55 changes: 0 additions & 55 deletions peptide/peptide.py

This file was deleted.

17 changes: 0 additions & 17 deletions tests/test_search.py
Original file line number Diff line number Diff line change
@@ -1,7 +1,6 @@
from unittest import TestCase

from files.files import Files
from peptide.peptide import Peptide
from project.project import Project


Expand Down Expand Up @@ -38,22 +37,6 @@ def test_search_projects(self):
"submission_date")
assert len(result['_embedded']['compactprojects']) == 1

def test_peptide_evidences(self):
"""
A test method to search peptide evidences
"""
search = Peptide()

result = search.peptide_evidences("PXD019134",
"", "", "", "QPAYMTMKGSALSFQWIEMSSAHSLERNLAK", 100, 0, "ASC",
"projectAccession")
assert len(result['_embedded']['peptideevidences']) == 1

result = search.peptide_evidences("", "",
"gi|215496908-DECOY", "", "QPAYMTMKGSALSFQWIEMSSAHSLERNLAK", 100, 0,
"ASC", "projectAccession")
assert len(result['_embedded']['peptideevidences']) == 1

def test_search_files(self):
"""
A test method to search files
Expand Down

0 comments on commit a9e2ee4

Please sign in to comment.